PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG026349t1
Common NameTCM_026349
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bZIP
Protein Properties Length: 414aa    MW: 44897.7 Da    PI: 6.8146
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG026349t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.59.2e-16208264359
                       XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                       + kr rr+ +NRe+ArrsR+RK+a + eLe+ v +L  eN +L k+l  +++++ + 
  Thecc1EG026349t1 208 DAKRVRRMLSNRESARRSRRRKQAHLTELETQVGQLRVENASLMKRLADISQKYNEA 264
                       68*********************************************9999988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.9E-18206270IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.553208263IPR004827Basic-leucine zipper domain
PfamPF001702.0E-13209262IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.7E-13210262No hitNo description
SuperFamilySSF579592.09E-11210260No hitNo description
PROSITE patternPS000360213228IPR004827Basic-leucine zipper domain
PfamPF124985.5E-38277402IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071215Biological Processcellular response to abscisic acid stimulus
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MDRVFSVEEI SDHFWSSSSA VSAADDDKKP GSKMNRSASE WAFQQFLREE ADRKGEDKKE  60
EEEEAKEELK KKENGVMTSS NGGLENKDKN NIPADSEEYQ AFLKTKLNLA CAAVAMSRAS  120
FLKSQDSAAR ADSGSQASNS PQLGSKATSK GAGNKDGNAP VEIPSLPNGQ KKSVAQVRPS  180
TSGSSRELSE EDEVEGENET MENMDPADAK RVRRMLSNRE SARRSRRRKQ AHLTELETQV  240
GQLRVENASL MKRLADISQK YNEAAVDNRV LKADVETLRA KVKMAEETVK RITGLNPLLH  300
GSPEISTMAM SSFDGSPSDT STDAAVPVQD GPKHPLYRAA ANNPIFAHDL RVSNALADIS  360
SAENIQPNSG GSTVPGNKIG WTASLQRVAS LEHLQKRIRG GVSPCGPKSN REQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1222229RRSRRRKQ
2224229SRRRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00040PBMTransfer from AT5G28770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007030574.10.0Light-inducible protein CPRF-2, putative
SwissprotQ990901e-130CPRF2_PETCR; Light-inducible protein CPRF2
TrEMBLA0A061F2070.0A0A061F207_THECC; Light-inducible protein CPRF-2, putative
STRINGPOPTR_0013s03800.11e-159(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM68462743
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.21e-78bZIP family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]